PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013635582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 390aa    MW: 43618.1 Da    PI: 5.1062
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013635582.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd++l  +++  G g+W++ ++  g++R++k+c++rw +yl
   XP_013635582.1 14 RGRWTAEEDQILSSYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWVNYL 61
                     8*********************************************97 PP

2Myb_DNA-binding55.99.8e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+el v+ +  lG++ W++Ia++++ gRt++++k++w+++l
   XP_013635582.1  67 RGNITPEEEELVVKMHSTLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.027961IPR017930Myb domain
SuperFamilySSF466893.45E-2811108IPR009057Homeodomain-like
SMARTSM007171.1E-111363IPR001005SANT/Myb domain
PfamPF002492.8E-141461IPR001005SANT/Myb domain
CDDcd001671.31E-81661No hitNo description
PROSITE profilePS5129426.03362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2565116IPR009057Homeodomain-like
SMARTSM007174.3E-1766114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.58E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MGRAPCCEKV GIKRGRWTAE EDQILSSYIQ SNGEGSWRSL PKNAGLKRCG KSCRLRWVNY  60
LRSDLRRGNI TPEEEELVVK MHSTLGNRWS LIASHLPGRT DNEIKNYWNS HLSRKLHYIR  120
KSHNVPAVTM NPPPTSQRLP EKRRPGRTSR SAMKPKTHKP KTRKTKKTSA QPEPDANVAI  180
NAVVGEDALM MELSGAEADV GPRDDYYYGA CHEGGDWCYT NNNNNNNNNN NNNNNNLLSI  240
NGDNGVLSFD EHDIIDLLLD ESDPGNVFTS SVGDGELSPL GDSTLARGSS ETSNLGNLDC  300
LQPCRSVESF LNYEHQVNDA LTDEFIDWEF VWQEGNKSNK ICDEKEASDP VVSWLLNGDD  360
EATIGQSNCE KFGEPLDHDE ENALVAWLLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-221211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3171420.0HQ317142.1 Brassica rapa subsp. rapa cultivar Tsuda MYB domain protein 12 (MYB12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635582.10.0PREDICTED: transcription factor MYB12-like
SwissprotO222641e-169MYB12_ARATH; Transcription factor MYB12
TrEMBLF2X1R90.0F2X1R9_BRARR; MYB domain protein 12
STRINGBra004456.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-164myb domain protein 12